2.50 Rating by CuteStat

llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk is 1 decade 8 years old. It is a domain having org.uk extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 3,140
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

94.136.40.82

Hosted Country:

United Kingdom GB

Location Latitude:

53.7945

Location Longitude:

-1.5524

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 16
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 94.136.40.82)

IT Solutions & Services for Home, Business & Public Sector – Misco.co.

- comet.co.uk

Buy the latest Laptops, Desktops, Tablets & more! Amazing deals for large & small business, public sector & home offices

92,288 $ 157,680.00

Home | The SMAE Institute

- thatfootsite.com

Your default description here

Not Applicable $ 8.95

SITE NOT FOUND

- systemsengineeringjobs.com
Not Applicable $ 8.95

CCTV Supplier & Manufacturer - Trade Suppliers - Qvis Global

- adata.co.uk

Trusted CCTV Supplier to professional installers. We offer a range of innovative CCTV and Security products with 3 Year Warranty, Free Next Day Delivery on UK orders over £50 and Free Customer Support

Not Applicable $ 8.95

Jules Makes Things

- angryamoeba.co.uk

Software architect at Riot Games. Lover of games and game systems. Opinions are my own.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: openresty/1.15.8.2
Date: Sat, 28 Dec 2019 12:03:16 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip
X-Proxy-Cache: MISS

Domain Information

Domain Registrar: 123-Reg Limited t/a 123-reg [Tag = 123-REG]
Registration Date: Jul 1, 2005, 12:00 AM 1 decade 8 years 9 months ago
Expiration Date: Jul 1, 2021, 12:00 AM 2 years 10 months 4 days ago
Domain Status:
registered until expiry date.

Domain Nameserver Information

Host IP Address Country
ns.123-reg.co.uk 212.67.202.2 United Kingdom United Kingdom
ns2.123-reg.co.uk 62.138.132.21 Germany Germany

DNS Record Analysis

Host Type TTL Extra
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk A 10796 IP: 94.136.40.82
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk NS 14400 Target: ns.hosteurope.com
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk NS 14400 Target: ns2.hosteurope.com
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk SOA 10800 MNAME: ns.hosteurope.com
RNAME: hostmaster.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk
Serial: 2006112402
Refresh: 86400
Retry: 3600
Expire: 1209600
Minimum TTL: 14400

Full WHOIS Lookup

Domain name:
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 13-Nov-2018

Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 01-Jul-2005
Expiry date: 01-Jul-2021
Last updated: 24-Jun-2019

Registration status:
Registered until expiry date.

Name servers:
ns.123-reg.co.uk 212.67.202.2
ns2.123-reg.co.uk 62.138.132.21

WHOIS lookup made at 12:03:25 28-Dec-2019

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2019.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.