Web Analysis for Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf - llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk is 1 decade 8 years old. It is a domain having org.uk extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 3,140 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 16 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 94.136.40.82)
IT Solutions & Services for Home, Business & Public Sector – Misco.co.
Buy the latest Laptops, Desktops, Tablets & more! Amazing deals for large & small business, public sector & home offices
CCTV Supplier & Manufacturer - Trade Suppliers - Qvis Global
Trusted CCTV Supplier to professional installers. We offer a range of innovative CCTV and Security products with 3 Year Warranty, Free Next Day Delivery on UK orders over £50 and Free Customer Support
Jules Makes Things
Software architect at Riot Games. Lover of games and game systems. Opinions are my own.
HTTP Header Analysis
Server: openresty/1.15.8.2
Date: Sat, 28 Dec 2019 12:03:16 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip
X-Proxy-Cache: MISS
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns.123-reg.co.uk | 212.67.202.2 | United Kingdom | |
ns2.123-reg.co.uk | 62.138.132.21 | Germany |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk | A | 10796 |
IP: 94.136.40.82 |
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk | NS | 14400 |
Target: ns.hosteurope.com |
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk | NS | 14400 |
Target: ns2.hosteurope.com |
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk | SOA | 10800 |
MNAME: ns.hosteurope.com RNAME: hostmaster.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk Serial: 2006112402 Refresh: 86400 Retry: 3600 Expire: 1209600 Minimum TTL: 14400 |
Full WHOIS Lookup
llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk
Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 13-Nov-2018
Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk
Relevant dates:
Registered on: 01-Jul-2005
Expiry date: 01-Jul-2021
Last updated: 24-Jun-2019
Registration status:
Registered until expiry date.
Name servers:
ns.123-reg.co.uk 212.67.202.2
ns2.123-reg.co.uk 62.138.132.21
WHOIS lookup made at 12:03:25 28-Dec-2019
--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2019.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.